PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf03525g01039.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 482aa    MW: 54545.3 Da    PI: 9.346
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf03525g01039.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF551e-171050242
                              ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                    SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                              +i n+s r+ tf kR++g++KK +ELS+LC+++++ ii+s+
  Peinf101Scf03525g01039.1 10 FITNDSSRKATFKKRKKGLMKKVSELSTLCGIDACAIIYSP 50
                              89**************************************8 PP

2SRF-TF551e-17232272242
                               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                    SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42 
                               +i n+s r+ tf kR++g++KK +ELS+LC+++++ ii+s+
  Peinf101Scf03525g01039.1 232 FITNDSSRKATFKKRKKGLMKKVSELSTLCGIDACAIIYSP 272
                               89**************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.2E-25160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.156149IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.76E-24185IPR002100Transcription factor, MADS-box
CDDcd002665.31E-21285No hitNo description
PRINTSPR004044.6E-8323IPR002100Transcription factor, MADS-box
PfamPF003199.7E-191051IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-82338IPR002100Transcription factor, MADS-box
SMARTSM004327.8E-18228282IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.02E-21228317IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.367228271IPR002100Transcription factor, MADS-box
CDDcd002666.24E-18228307No hitNo description
PfamPF003199.7E-19232273IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MTRKKVKLAF ITNDSSRKAT FKKRKKGLMK KVSELSTLCG IDACAIIYSP YENQPEVWPN  60
TMGAQRVLAE FKKMPEMEQS KKMVNQESFI RQRIAKASEQ LKKQSKENRE KEMTEVMYQC  120
LTGKGLQNLN LGDLNDLGWV VDQNLKEIYK RIEALKKGAS TSSQAAVTAP VEQKPVVELG  180
LEGMKQRTQA EWFTDWMNNT STSDQHIGFG HGDEMIIPNF NDNHNTSVKL AFITNDSSRK  240
ATFKKRKKGL MKKVSELSTL CGIDACAIIY SPYENQPEVW PNTMGAQRVL AEFKKMPEME  300
QSKKMVNQES FIRQRIAKAS EQLKKQSKEN REKEMTEVMY QCLTRKGLQN LNLGDLNDLG  360
WVVDQNLKEI YKRIEALKKG ASSSSSASSQ AAVTAPVEQK PVVELGLEGM QAAVTAPVEQ  420
KPVVELGLEG MQQRTQAEWF TDWMNNTSTS DQHIGFGHGD EMIIPNFNDN HNTSVWSNGF  480
FP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAFITNDSSRKATFKKRK
2243247KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00553DAPTransfer from AT5G48670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ1685100.0FJ168510.1 Petunia x hybrida type I MADS box transcription factor (MADSy5) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774462.11e-136PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK38e-65AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLB6DT621e-149B6DT62_PETHY; Type I MADS box transcription factor
STRINGSolyc01g102260.2.11e-124(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15322367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-57AGAMOUS-like 80